PDB entry 1ubc

View 1ubc on RCSB PDB site
Description: Structure of Reca Protein
Class: recombination
Keywords: recombination, DNA-repair
Deposited on 2003-04-04, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.242
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RecA
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ubca1, d1ubca2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ubcA (A:)
    maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr
    grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq
    pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm
    tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav
    gnrtrvkvvknkvsppfkqaefdilygqgisregslidmgvehgfirksgswftyegeql
    gqgkenarkfllentdvaneiekkikeklgigavvtaeaddvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubcA (A:)
    apdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrvi
    eiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdtg
    eqaleiadmlvrsgaldiividsvaalvpraeieglqarlmsqalrkmtgalnnsgttai
    finqtggkalkfyasvrldvrrietlkdgtdavgnrtrvkvvknkvsppfkqaefdilyg
    qgisregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkike
    klg