PDB entry 1ubb

View 1ubb on RCSB PDB site
Description: Crystal structure of rat HO-1 in complex with ferrous heme
Class: oxidoreductase
Keywords: Oxidoreductase, Microsome, Multigene family
Deposited on 2003-04-03, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ubba_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ubbA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubbA (A:)
    qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
    npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
    ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
    mtpevkhrvteeaktafllnielfeelqallt