PDB entry 1uba

View 1uba on RCSB PDB site
Description: c-terminal uba domain from the human homolog of rad23 (hhr23a)
Deposited on 1998-07-27, released 1998-08-05
The last revision was dated 2000-02-11, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hhr23a)
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ubaA (A:)
    qekeaierlkalgfpeslviqayfaceknenlaanfllsqnfdde