PDB entry 1ub9

View 1ub9 on RCSB PDB site
Description: Structure of the transcriptional regulator homologue protein from Pyrococcus horikoshii OT3
Deposited on 2003-04-03, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ub9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub9A (A:)
    meelkeimkshilgnpvrlgimifllprrkapfsqiqkvldltpgnldshirvlernglv
    ktykviadrprtvveitdfgmeeakrflsslkavidgldl