PDB entry 1ub9

View 1ub9 on RCSB PDB site
Description: Structure of the transcriptional regulator homologue protein from Pyrococcus horikoshii OT3
Class: transcription
Keywords: helix-turn-helix motif, winged helix motif, STRUCTURAL GENOMICS, TRANSCRIPTION
Deposited on 2003-04-03, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PH1061
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1061
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub9A (A:)
    meelkeimkshilgnpvrlgimifllprrkapfsqiqkvldltpgnldshirvlernglv
    ktykviadrprtvveitdfgmeeakrflsslkavidgldl