PDB entry 1ub7

View 1ub7 on RCSB PDB site
Description: The Crystal Analysis of Beta-Keroacyl-[Acyl Carrier Protein] Synthase III (FABH)From Thermus Thermophilus.
Class: transferase
Keywords: Fatty acid synthesis, Beta-Ketoacyl-ACP Synthase III, FABH, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2003-03-31, released 2003-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] synthase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ub7a1, d1ub7a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] synthase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ub7b1, d1ub7b2
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] synthase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ub7c1, d1ub7c2
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] synthase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ub7d1, d1ub7d2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ub7A (A:)
    msgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkaved
    llrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqa
    halveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlga
    dgtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedi
    rlfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdh
    vllvsfgagltwaaavltwgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub7A (A:)
    sgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkavedl
    lrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqah
    alveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlgad
    gtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedir
    lfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdhv
    llvsfgagltwaaavltwgga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ub7B (B:)
    msgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkaved
    llrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqa
    halveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlga
    dgtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedi
    rlfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdh
    vllvsfgagltwaaavltwgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub7B (B:)
    sgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkavedl
    lrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqah
    alveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlgad
    gtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedir
    lfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdhv
    llvsfgagltwaaavltwgga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ub7C (C:)
    msgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkaved
    llrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqa
    halveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlga
    dgtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedi
    rlfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdh
    vllvsfgagltwaaavltwgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub7C (C:)
    sgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkavedl
    lrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqah
    alveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlgad
    gtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedir
    lfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdhv
    llvsfgagltwaaavltwgga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ub7D (D:)
    msgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkaved
    llrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqa
    halveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlga
    dgtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedi
    rlfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdh
    vllvsfgagltwaaavltwgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub7D (D:)
    sgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkavedl
    lrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqah
    alveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygfrsfvlgad
    gtgakelyhacvaprlpdgtsmknrlymngrevfkfavrvmntatleaiekagltpedir
    lfvphqanlriidaarerlglpwervavnvdrygntstasiplalkeavdagriregdhv
    llvsfgagltwaaavltwgga