PDB entry 1ub6

View 1ub6 on RCSB PDB site
Description: Crystal structure of Antibody 19G2 with sera ligand
Deposited on 2003-03-30, released 2004-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.264
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub6A (A:)
    aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
    svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvsaakttpps
    vypaapgcgdttgssvtlgclvkgyfpesvtvtwnsggssvhtfpallqsglytmsssvt
    vpsstwpstvtcsvahpasgttvdkkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub6B (B:)
    aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
    gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhngytceathktstspivksf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub6H (H:)
    aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
    svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvsaakttpps
    vypaapgcgdttgssvtlgclvkgyfpesvtvtwnsggssvhtfpallqsglytmsssvt
    vpsstwpstvtcsvahpasgttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub6L (L:)
    aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
    gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhngytceathktstspivksf