PDB entry 1ub5

View 1ub5 on RCSB PDB site
Description: Crystal structure of Antibody 19G2 with hapten at 100K
Deposited on 2003-03-30, released 2004-04-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.248
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5A (A:)
    evkllesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityyp
    dsvagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvssakttpp
    svypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssv
    tvpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5B (B:)
    divmtqaafsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnla
    sgvpnrfsssgsgtdftlrisrveaedvgvyycaqnlelpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhngytceathktstspivksf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5H (H:)
    evkllesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityyp
    dsvagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvssakttpp
    svypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssv
    tvpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5L (L:)
    divmtqaafsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnla
    sgvpnrfsssgsgtdftlrisrveaedvgvyycaqnlelpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhngytceathktstspivksf