PDB entry 1ub3

View 1ub3 on RCSB PDB site
Description: Crystal Structure of Tetrameric Structure of Aldolase from thermus thermophilus HB8
Class: lyase
Keywords: Schiff base, deoxyribose phosphate, carbinolamine, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2003-03-28, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.202
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub3a_
  • Chain 'B':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub3b_
  • Chain 'C':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub3c_
  • Chain 'D':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub3d_
  • Heterogens: HPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ub3A (A:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub3A (A:)
    dlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtvv
    gfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqavl
    kviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvka
    aggirdretalrmlkagasrlgtssgvalva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ub3B (B:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub3B (B:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ub3C (C:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub3C (C:)
    dlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtvv
    gfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqavl
    kviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvka
    aggirdretalrmlkagasrlgtssgvalv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ub3D (D:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub3D (D:)
    dlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtvv
    gfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqavl
    kviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvka
    aggirdretalrmlkagasrlgtssgvalva