PDB entry 1ub2

View 1ub2 on RCSB PDB site
Description: Crystal structure of catalase-peroxidase from Synechococcus PCC 7942
Class: oxidoreductase
Keywords: catalase-peroxidase, catalase, peroxidase, KatG, Synechococcus PCC 7942, Cyanobacteria, OXIDOREDUCTASE
Deposited on 2003-03-28, released 2004-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub2a1, d1ub2a2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ub2A (A:)
    mtatqgkcpvmhggattvnistaewwpkalnldilsqhdrktnpmgpdfnyqeevqklda
    alkqdlqalmtdsqdwwpadwghygglmirltwhaagtyriadgrggagtgnqrfaplns
    wpdntnldkarrllwpikqkygnklswadliayagtiayesmglktfgfafgrediwhpe
    kdiywgpekewfppstnpnsrytgdrelenplaavtmgliyvnpegvdgnpdplktahdv
    rvtfarmamndeetvaltagghtvgkchgngnaallgpepegadvedqglgwinktqsgi
    grnavtsglegawtphptqwdngyfavcslnydwelkknpagawqwepinpreedlpvdv
    edpsirrnlvmtdadmamkmdpeyrkiserfyqdpayfadvfarawfklthrdmgpkary
    igpdvpqedliwqdpipagnrnydvqavkdriaasglsiselvstawdsartyrnsdkrg
    gangarirlapqkdwegnepdrlpkvlavlegisaatgatvadvivlagnvgveqkaraa
    gveivlpfapgrgdataeqtdtesfavlepihdaiatgssrtmrqrlknccliatqllgl
    tapemtvligglrvlgtnhggtkhvvftdregvltndffvnltdmnylwkpagknlyeic
    drktnqvkwtatrvdlvfgsnsilrayselyaqddnkekfvrdfvaawtkvmnadrfdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub2A (A:)
    staewwpkalnldilsqhdrktnpmgpdfnyqeevqkldaalkqdlqalmtdsqdwwpad
    wghygglmirltwhaagtyriadgrggagtgnqrfaplnswpdntnldkarrllwpikqk
    ygnklswadliayagtiayesmglktfgfafgrediwhpekdiywgpekewfppstnpns
    rytgdrelenplaavtmgliyvnpegvdgnpdplktahdvrvtfarmamndeetvaltag
    ghtvgkchgngnaallgpepegadvedqglgwinktqsgigrnavtsglegawtphptqw
    dngyfavcslnydwelkknpagawqwepinpreedlpvdvedpsirrnlvmtdadmamkm
    dpeyrkiserfyqdpayfadvfarawfklthrdmgpkaryigpdvpqedliwqdpipagn
    rnydvqavkdriaasglsiselvstawdsartyrnsdkrggangarirlapqkdwegnep
    drlpkvlavlegisaatgatvadvivlagnvgveqkaraagveivlpfapgrgdataeqt
    dtesfavlepihdaiatgssrtmrqrlknccliatqllgltapemtvligglrvlgtnhg
    gtkhvvftdregvltndffvnltdmnylwkpagknlyeicdrktnqvkwtatrvdlvfgs
    nsilrayselyaqddnkekfvrdfvaawtkvmnadrfdld