PDB entry 1ub1

View 1ub1 on RCSB PDB site
Description: Solution structure of the matrix attachment region-binding domain of chicken MeCP2
Class: transcription
Keywords: Chicken methyl-CpG-binding protein 2 (cMeCP2), MAR-binding protein (ARBP), NMR spectroscopy, protein-DNA interaction, Structural Proteomics in Europe, SPINE, Structural Genomics, TRANSCRIPTION
Deposited on 2003-03-27, released 2003-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: attachment region binding protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ub1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ub1A (A:)
    mghhhhhhapavpeasaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydv
    ylinpqgkafrskveliayfekvgdtsldpndfdftvtgrgspsrreqrppkkakspksp
    gsgrgrgrpkgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub1A (A:)
    apavpeasaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgk
    afrskveliayfekvgdtsldpndfdftvtgrgspsrreqrppkkakspkspgsgrgrgr
    pkgsg