PDB entry 1ub1

View 1ub1 on RCSB PDB site
Description: Solution structure of the matrix attachment region-binding domain of chicken MeCP2
Deposited on 2003-03-27, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ub1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ub1A (A:)
    mghhhhhhapavpeasaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydv
    ylinpqgkafrskveliayfekvgdtsldpndfdftvtgrgspsrreqrppkkakspksp
    gsgrgrgrpkgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ub1A (A:)
    apavpeasaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgk
    afrskveliayfekvgdtsldpndfdftvtgrgspsrreqrppkkakspkspgsgrgrgr
    pkgsg