PDB entry 1uaz

View 1uaz on RCSB PDB site
Description: Crystal structure of archaerhodopsin-1
Class: proton transport
Keywords: Proton pump, retinal protein, 7 trans-membrane helices, PROTON TRANSPORT
Deposited on 2003-03-26, released 2003-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.23
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: archaerhodopsin-1
    Species: Halobacterium sp. AUS-1 [TaxId:2244]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uaza_
  • Chain 'B':
    Compound: archaerhodopsin-1
    Species: Halobacterium sp. AUS-1 [TaxId:2244]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uazb_
  • Heterogens: RET

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uazA (A:)
    taavgadllgdgrpetlwlgigtllmligtfyfivkgwgvtdkeareyysitilvpgias
    aaylsmffgigltevqvgsemldiyyaryadwlfttplllldlallakvdrvsigtlvgv
    dalmivtglvgalshtplarytwwlfsticmivvlyflatslraaakergpevastfntl
    talvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrailgdte
    apepsagaeasaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uazA (A:)
    taavgadllgdgrpetlwlgigtllmligtfyfivkgwgvtdkeareyysitilvpgias
    aaylsmffgigltevqvgsemldiyyaryadwlfttplllldlallakvdrvsigtlvgv
    dalmivtglvgalshtplarytwwlfsticmivvlyflatslraaakergpevastfntl
    talvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrail
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uazB (B:)
    taavgadllgdgrpetlwlgigtllmligtfyfivkgwgvtdkeareyysitilvpgias
    aaylsmffgigltevqvgsemldiyyaryadwlfttplllldlallakvdrvsigtlvgv
    dalmivtglvgalshtplarytwwlfsticmivvlyflatslraaakergpevastfntl
    talvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrailgdte
    apepsagaeasaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uazB (B:)
    taavgadllgdgrpetlwlgigtllmligtfyfivkgwgvtdkeareyysitilvpgias
    aaylsmffgigltevqvgsemldiyyaryadwlfttplllldlallakvdrvsigtlvgv
    dalmivtglvgalshtplarytwwlfsticmivvlyflatslraaakergpevastfntl
    talvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrail