PDB entry 1uay

View 1uay on RCSB PDB site
Description: Crystal Structure of Type II 3-Hydroxyacyl-CoA Dehydrogenase from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: DEHYDROGENASE, BETA OXIDATION, FATTY ACID, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, oxidoreductase
Deposited on 2003-03-25, released 2003-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.181
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II 3-hydroxyacyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uaya_
  • Chain 'B':
    Compound: Type II 3-hydroxyacyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uayb_
  • Heterogens: ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uayA (A:)
    mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
    aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
    pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
    fdtpllqglpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrma
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uayA (A:)
    ersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravara
    qeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenpp
    daegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapglf
    dtpllqglpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrmap
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uayB (B:)
    mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
    aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
    pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
    fdtpllqglpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrma
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uayB (B:)
    mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
    aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
    pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
    fdtplpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrmapr