PDB entry 1uay

View 1uay on RCSB PDB site
Description: Crystal Structure of Type II 3-Hydroxyacyl-CoA Dehydrogenase from Thermus thermophilus HB8
Deposited on 2003-03-25, released 2003-04-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-15, with a file datestamp of 2003-04-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.181
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1uaya_
  • Chain 'B':
    Domains in SCOP 1.65: d1uayb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uayA (A:)
    mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
    aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
    pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
    fdtpllqglpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrma
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uayA (A:)
    ersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravara
    qeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenpp
    daegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapglf
    dtpllqglpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrmap
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uayB (B:)
    mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
    aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
    pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
    fdtpllqglpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrma
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uayB (B:)
    mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravar
    aqeeaplfavvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenp
    pdaegqrgvivntasvaafegqigqaayaaskggvvaltlpaarelagwgirvvtvapgl
    fdtplpekakaslaaqvpfpprlgrpeeyaalvlhilenpmlngevvrldgalrmapr