PDB entry 1uax

View 1uax on RCSB PDB site
Description: Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3
Deposited on 2003-03-24, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.255
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uaxa_
  • Chain 'B':
    Domains in SCOP 1.69: d1uaxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uaxA (A:)
    mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
    ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
    glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
    eeyykqygdfppivrrtwetarkieerfrknqltldkflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uaxA (A:)
    mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
    ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
    glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
    eeyykqygdfppivrrtwetarkieerfrkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uaxB (B:)
    mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
    ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
    glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
    eeyykqygdfppivrrtwetarkieerfrknqltldkflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uaxB (B:)
    mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
    ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
    glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
    eeyykqygdfppivrrtwetarkieerfrkn