PDB entry 1uaw

View 1uaw on RCSB PDB site
Description: solution structure of the n-terminal rna-binding domain of mouse musashi1
Deposited on 2003-03-24, released 2004-03-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-24, with a file datestamp of 2004-03-24.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1uawa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uawA (A:)
  ckmfigglswqttqeglreyfgqfgevkeclvmrdpltkrsrgfgfvtfmdqagvdkvla
  qsrheldsktidpkvaf