PDB entry 1uaw

View 1uaw on RCSB PDB site
Description: Solution structure of the N-terminal RNA-binding domain of mouse Musashi1
Class: RNA binding protein
Keywords: RNP-type structure, RNA BINDING PROTEIN
Deposited on 2003-03-24, released 2004-03-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mouse-musashi-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uawa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uawA (A:)
    ckmfigglswqttqeglreyfgqfgevkeclvmrdpltkrsrgfgfvtfmdqagvdkvla
    qsrheldsktidpkvaf