PDB entry 1uat

View 1uat on RCSB PDB site
Description: The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J
Class: electron transport
Keywords: beta-barrel, ELECTRON TRANSPORT
Deposited on 2003-03-19, released 2004-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin iso-2
    Species: Methylomonas sp. J [TaxId:32038]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1uata_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uatA (A:)
    ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
    kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
    mrgtlklee