PDB entry 1uas

View 1uas on RCSB PDB site
Description: Crystal structure of rice alpha-galactosidase
Class: hydrolase
Keywords: TIM-barrel, beta-alpha-barrel, greek key motif, hydrolase
Deposited on 2003-03-18, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-galactosidase
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uasa1, d1uasa2
  • Heterogens: GLA, SO4, PT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uasA (A:)
    fenglgrtpqmgwnswnhfycgineqiiretadalvntglaklgyqyvniddcwaeysrd
    sqgnfvpnrqtfpsgikaladyvhakglklgiysdagsqtcsnkmpgsldheeqdvktfa
    swgvdylkydncndagrsvmerytrmsnamktygkniffslcewgkenpatwagrmgnsw
    rttgdiadnwgsmtsradendqwaayagpggwndpdmlevgnggmseaeyrshfsiwala
    kaplligcdvrsmsqqtknilsnseviavnqdslgvqgkkvqsdnglevwagplsnnrka
    vvlwnrqsyqatitahwsniglagsvavtardlwahssfaaqgqisasvaphdckmyvlt
    pn