PDB entry 1uaq

View 1uaq on RCSB PDB site
Description: The crystal structure of yeast cytosine deaminase
Class: Hydrolase
Keywords: alpha-beta-alpha, Hydrolase
Deposited on 2003-03-14, released 2003-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: fcy1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uaqa_
  • Chain 'B':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: fcy1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uaqb_
  • Heterogens: ZN, DUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uaqA (A:)
    mvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsat
    lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgek
    ylqtrghevvvvdderckkimkqfiderpqdwfedige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uaqA (A:)
    skwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeist
    lencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrgh
    evvvvdderckkimkqfiderpqdwfedige
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uaqB (B:)
    mvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsat
    lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgek
    ylqtrghevvvvdderckkimkqfiderpqdwfedige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uaqB (B:)
    skwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeist
    lencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrgh
    evvvvdderckkimkqfiderpqdwfedige