PDB entry 1uap

View 1uap on RCSB PDB site
Description: NMR structure of the NTR domain from human PCOLCE1
Class: protein binding
Keywords: beta barrel, protein binding
Deposited on 2003-03-14, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Procollagen C-proteinase enhancer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PCOLCE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15113 (24-153)
      • cloning artifact (23)
    Domains in SCOPe 2.07: d1uapa1, d1uapa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uapA (A:)
    mgsshhhhhhssglvprgshmlespdaptcpkqcrrtgtlqsnfcasslvvtatvksmvr
    epgeglavtvsligayktggldlpspptgaslkfyvpckqcppmkkgvsyllmgqveenr
    gpvlppesfvvlhrpnqdqiltnlskrkcpsqpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uapA (A:)
    spdaptcpkqcrrtgtlqsnfcasslvvtatvksmvrepgeglavtvsligayktggldl
    pspptgaslkfyvpckqcppmkkgvsyllmgqveenrgpvlppesfvvlhrpnqdqiltn
    lskrkcpsqpv