PDB entry 1uan

View 1uan on RCSB PDB site
Description: Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Rossmann-like, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-03-12, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TT1542
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uana_
  • Chain 'B':
    Compound: hypothetical protein TT1542
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uanb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uanA (A:)
    mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
    ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
    avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftge
    aasetvgpkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uanA (A:)
    mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
    ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
    avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftvg
    pkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uanB (B:)
    mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
    ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
    avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftge
    aasetvgpkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uanB (B:)
    mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
    ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
    avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqfvgp
    kgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra