PDB entry 1uak

View 1uak on RCSB PDB site
Description: Crystal structure of tRNA(m1G37)methyltransferase: Insight into tRNA recognition
Class: transferase
Keywords: methyltransferase, SPOUT class, trmD, tRNA(m1G37)methyltransferase, tRNA modification, TRANSFERASE
Deposited on 2003-03-11, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43912 (20-265)
      • expression tag (18-19)
      • expression tag (266-269)
    Domains in SCOPe 2.07: d1uaka1, d1uaka2, d1uaka3
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uakA (A:)
    mgsshhhhhhssglvprgshmwigvislfpemfkaitefgvtgravkhnllkvecwnprd
    ftfdkhktvddrpygggpgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvt
    elaqnqklilvcgryegiderliqteideewsigdyvltggelpamtlidavarfipgvl
    gkqasaeedsfadglldcphytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrr
    pelleglaltdeqrkllkeaqaehnslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uakA (A:)
    shmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggp
    gmlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegi
    derliqteideewsigdyvltggelpamtlidavarfipgvlsfadglldcphytrpevl
    egltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehnsl
    ehh