PDB entry 1uai

View 1uai on RCSB PDB site
Description: Crystal Structure of the Alginate Lyase from Corynebacterium sp.
Class: lyase
Keywords: jellyroll beta-sandwich, lyase
Deposited on 2003-03-11, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyguluronate lyase
    Species: Corynebacterium sp. [TaxId:1720]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uaia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uaiA (A:)
    aepcdypaqqldltdwkvtlpigssgkpseieqpaldtfatapwfqvnakctgvqfraav
    ngvttsgsgyprselremtdggeekaswsatsgthtmvfreafnhlpevkphlvgaqihd
    gdddvtvfrlegtslyitkgddthhklvtsdyklntvfegkfvvsggkikvyyngvlqtt
    ishtssgnyfkagaytqancsnsspcsssnygqvslyklqvths
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uaiA (A:)
    epcdypaqqldltdwkvtlpigssgkpseieqpaldtfatapwfqvnakctgvqfraavn
    gvttsgsgyprselremtdggeekaswsatsgthtmvfreafnhlpevkphlvgaqihdg
    dddvtvfrlegtslyitkgddthhklvtsdyklntvfegkfvvsggkikvyyngvlqtti
    shtssgnyfkagaytqancsnsspcsssnygqvslyklqvths