PDB entry 1uah

View 1uah on RCSB PDB site
Description: Structure of beta-Glucosidase at atomic resolution from Thermus thermophilus HB8
Class: hydrolase
Keywords: Glucosidase, atomic resolution, glycosyl hydrase
Deposited on 2003-03-11, released 2003-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-06-24, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.122
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glycosidase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • GB AAN05439
    Domains in SCOPe 2.07: d1uaha_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uahA (A:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvry
    lppegpatamgwevypeglyhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsal
    wyreriaraqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uahA (A:)
    naekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedi
    almqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlp
    laleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglr
    nleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffl
    dpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvrylpp
    egpatamgwevypeglyhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayle
    ahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsalwyr
    eriara