PDB entry 1uaa

View 1uaa on RCSB PDB site
Description: e. coli rep helicase/DNA complex
Class: hydrolase/DNA
Keywords: complex (helicase/DNA), helicase, DNA unwinding, hydrolase/DNA complex
Deposited on 1997-06-30, released 1998-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ATP-dependent DNA helicase rep.)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uaaa1, d1uaaa2
  • Chain 'B':
    Compound: protein (ATP-dependent DNA helicase rep.)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uaab1, d1uaab2
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*t)-3')
    Species: Escherichia coli [TaxId:562]

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uaaA (A:)
    mrlnpgqqqavefvtgpclvlagagsgktrvitnkiahlirgcgyqarhiaavtftnkaa
    remkervgqtlgrkearglmistfhtlgldiikreyaalgmkanfslfddtdqlallkel
    teglieddkvllqqlistisnwkndlktpsqaaasaigerdrifahcyglydahlkacnv
    ldfddlillptlllqaneevrkrwqnkiryllvdeyqdtntsqyelvkllvgsrarftvv
    gdddqsiyswrgarpqnlvllsqdfpalkvikleqnyrssgrilkaaniliannphvfek
    rlfselgygaelkvlsanneeheaervtgeliahhfvnktqykdyailyrgnhqsrvfek
    flmqnripykisggtsffsrpeikdllaylrvltnpdddsaflrivntpkreigpatlkk
    lgewamtrnksmftasfdmglsqtlsgrgyealtrfthwlaeiqrlaerepiaavrdlih
    gmdyeswlyetspspkaaemrmknvnqlfswmtemlegseldepmtltqvvtrftlrdmm
    ergeseeeldqvqlmtlhaskglefpyvymvgmeegflphqssidednideerrlayvgi
    traqkeltftlckerrqygelvrpepsrfllelpqddliweqerkvvsaeermqkgqshl
    anlkammaakrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uaaA (A:)
    rlnpgqqqavefvtgpclvlagagsgktrvitnkiahlirgcgyqarhiaavtftnkaar
    emkervgqtlgrkearglmistfhtlgldiikreyaalgmkanfslfddtdqlallkelt
    eglieddkvllqqlistisnwkndlktpsqaaasaigerdrifahcyglydahlkacnvl
    dfddlillptlllqaneevrkrwqnkiryllvdeyqdtntsqyelvkllvgsrarftvvg
    dddqsiyswrgarpqnlvllsqdfpalkvikleqnyrssgrilkaaniliannphvfekr
    lfselgygaelkvlsanneeheaervtgeliahhfvnktqykdyailyrgnhqsrvfekf
    lmqnripykisggtsffsrpeikdllaylrvltnpdddsaflrivntpkreigpatlkkl
    gewamtrnksmftasfdmglsqtlsgrgyealtrfthwlaeiqrlaerepiaavrdlihg
    mdyeswlyetspspkaaemrmknvnqlfswmtemlegseldepmtltqvvtrftlrdmme
    reeeldqvqlmtlhaskglefpyvymvgmeegflphqssidednideerrlayvgitraq
    keltftlckerrqygelvrpepsrfllelpqddliw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uaaB (B:)
    mrlnpgqqqavefvtgpclvlagagsgktrvitnkiahlirgcgyqarhiaavtftnkaa
    remkervgqtlgrkearglmistfhtlgldiikreyaalgmkanfslfddtdqlallkel
    teglieddkvllqqlistisnwkndlktpsqaaasaigerdrifahcyglydahlkacnv
    ldfddlillptlllqaneevrkrwqnkiryllvdeyqdtntsqyelvkllvgsrarftvv
    gdddqsiyswrgarpqnlvllsqdfpalkvikleqnyrssgrilkaaniliannphvfek
    rlfselgygaelkvlsanneeheaervtgeliahhfvnktqykdyailyrgnhqsrvfek
    flmqnripykisggtsffsrpeikdllaylrvltnpdddsaflrivntpkreigpatlkk
    lgewamtrnksmftasfdmglsqtlsgrgyealtrfthwlaeiqrlaerepiaavrdlih
    gmdyeswlyetspspkaaemrmknvnqlfswmtemlegseldepmtltqvvtrftlrdmm
    ergeseeeldqvqlmtlhaskglefpyvymvgmeegflphqssidednideerrlayvgi
    traqkeltftlckerrqygelvrpepsrfllelpqddliweqerkvvsaeermqkgqshl
    anlkammaakrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uaaB (B:)
    rlnpgqqqavefvtgpclvlagagsgktrvitnkiahlirgcgyqarhiaavtftnkaar
    emkervgqtlgrkearglmistfhtlgldiikreyaalgmkanfslfddtdqlallkelt
    eglieddkvllqqlistisnwkndlktpsqaaasaigerdrifahcyglydahlkacnvl
    dfddlillptlllqaneevrkrwqnkiryllvdeyqdtntsqyelvkllvgsrarftvvg
    dddqsiyswrgarpqnlvllsqdfpalkvikleqnyrssgrilkaaniliannphvfekr
    lfselgygaelkvlsanneeheaervtgeliahhfvnktqykdyailyrgnhqsrvfekf
    lmqnripykisggtsffsrpeikdllaylrvltnpdddsaflrivntpkreigpatlkkl
    gewamtrnksmftasfdmglsqtlsgrgyealtrfthwlaeiqrlaerepiaavrdlihg
    mdyeswlyetspspkaaemrmknvnqlfswmtemlegseldepmtltqvvtrftlrdeel
    dqvqlmtlhaskglefpyvymvgmeegflphqssidednideerrlayvgitraqkeltf
    tlckerrqygelvrpepsrfllelpqddliweq
    

  • Chain 'C':
    No sequence available.