PDB entry 1ua8

View 1ua8 on RCSB PDB site
Description: Crystal structure of the lipoprotein localization factor, LolA
Class: protein transport
Keywords: unclosed beta barrel, PROTEIN TRANSPORT
Deposited on 2003-03-04, released 2003-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer-membrane lipoproteins carrier protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ua8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ua8A (A:)
    daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlfnwhmtqpdesilv
    sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
    ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
    rk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ua8A (A:)
    daasdlksrldkvssfhasftqkvtdgqegqgdlwvkrpnlfnwhmtqpdesilvsdgkt
    lwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkanlkqft
    invgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddqrk