PDB entry 1ua7

View 1ua7 on RCSB PDB site
Description: Crystal Structure Analysis of Alpha-Amylase from Bacillus Subtilis complexed with Acarbose
Class: hydrolase
Keywords: beta-alpha-barrels, acarbose, greek-key motif, hydrolase
Deposited on 2003-03-03, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00691 (0-421)
      • see remark 999 (101)
      • see remark 999 (159)
      • engineered (352)
    Domains in SCOPe 2.07: d1ua7a1, d1ua7a2
  • Heterogens: ACI, GLD, GLC, G6D, BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ua7A (A:)
    psiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwywlyq
    ptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnwthg
    ntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakhiel
    pddgsygsqfwpnitntsaefqygeilqdsasrdaayanymdvtasnyghsirsalknrn
    lgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgstplf
    fsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmagqpeelsnpqgnnqifm
    nqrgshgvvlanagsssvsintatklpdgrydnkagagsfqvndgkltgtinarsvavly
    pd