PDB entry 1ua5

View 1ua5 on RCSB PDB site
Description: Non-fusion GST from S. japonicum in complex with glutathione
Class: transferase
Keywords: transferase
Deposited on 2003-02-28, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ua5a1, d1ua5a2
  • Heterogens: SO4, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ua5A (A:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ua5A (A:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhp