PDB entry 1ua4

View 1ua4 on RCSB PDB site
Description: Crystal Structure of an ADP-dependent Glucokinase from Pyrococcus furiosus
Class: transferase
Keywords: transferase, kinase
Deposited on 2003-02-27, released 2004-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-dependent glucokinase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ua4a_
  • Heterogens: GLC, BGC, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ua4A (A:)
    mptweelyknaiekaiksvpkvkgvllgyntnidaikyldskdleeriikagkeevikys
    eelpdkintvsqllgsilwsirrgkaaelfvescpvrfymkrwgwnelrmggqagimanl
    lggvygvpvivhvpqlsrlqanlfldgpiyvptlengevklihpkefsgdeencihyiye
    fprgfrvfefeaprenrfigsaddynttlfireefresfseviknvqlailsglqaltke
    nykepfeivksnlevlnereipvhlefaftpdekvreeilnvlgmfysvglnevelasim
    eilgekklakellahdpvdpiavteamlklakktgvkrihfhtygyylalteykgehvrd
    allfaalaaaakamkgnitsleeireatsvpvnekatqveeklraeygikegigevegyq
    iafiptkivakpkstvgigdtisssafigefsftl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ua4A (A:)
    ptweelyknaiekaiksvpkvkgvllgyntnidaikyldskdleeriikagkeevikyse
    elpdkintvsqllgsilwsirrgkaaelfvescpvrfymkrwgwnelrmggqagimanll
    ggvygvpvivhvpqlsrlqanlfldgpiyvptlengevklihpkefsgdeencihyiyef
    prgfrvfefeaprenrfigsaddynttlfireefresfseviknvqlailsglqaltken
    ykepfeivksnlevlnereipvhlefaftpdekvreeilnvlgmfysvglnevelasime
    ilgekklakellahdpvdpiavteamlklakktgvkrihfhtygyylalteykgehvrda
    llfaalaaaakamkgnitsleeireatsvpvnekatqveeklraeygikegigevegyqi
    afiptkivakpkstvgigdtisssafigefsftl