PDB entry 1u9z

View 1u9z on RCSB PDB site
Description: Crystal Structure of Phosphoribosyl Diphosphate Synthase Complexed with AMP and Ribose 5-Phosphate
Class: transferase
Keywords: PRPP synthase; ribose 5-phosphate; adenosine 5'-monophosphate, TRANSFERASE
Deposited on 2004-08-11, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: PRS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9za1, d1u9za2
  • Chain 'B':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: PRS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9zb1, d1u9zb2
  • Chain 'C':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: PRS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9zc1, d1u9zc2
  • Chain 'D':
    Compound: Ribose-phosphate pyrophosphokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: PRS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9zd1, d1u9zd2
  • Heterogens: R5P, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9zA (A:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydylektrlspteiqiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaac
    vhpvligdalnklysagveevvgtdtylsevskvsvaevivdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9zA (A:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydyleiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaacvhpvligdal
    nklysagveevvgtdtylsevskvsvaevivdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u9zB (B:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydylektrlspteiqiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaac
    vhpvligdalnklysagveevvgtdtylsevskvsvaevivdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9zB (B:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydyleiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaacvhpvligdal
    nklysagveevvgtdtylsevskvsvaevivdll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u9zC (C:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydylektrlspteiqiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaac
    vhpvligdalnklysagveevvgtdtylsevskvsvaevivdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9zC (C:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydyleiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaacvhpvligdal
    nklysagveevvgtdtylsevskvsvaevivdll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u9zD (D:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydylektrlspteiqiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaac
    vhpvligdalnklysagveevvgtdtylsevskvsvaevivdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9zD (D:)
    mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn
    daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli
    tinphethikdfftipfiygdavpklaeyvkdklndpivlapdkgalefaktaskilnae
    ydyleiapktldakdrdvfivddiistggtmatavkllkeqgakkiiaacvhpvligdal
    nklysagveevvgtdtylsevskvsvaevivdll