PDB entry 1u9v

View 1u9v on RCSB PDB site
Description: Crystal Structure of the Cysteine Protease Human Cathepsin K in Complex with the Covalent Inhibitor NVP-ABE854
Class: hydrolase
Keywords: hydrolase, sulfhydryl proteinase
Deposited on 2004-08-11, released 2005-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9va_
  • Heterogens: IHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9vA (A:)
    grapdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvs
    endgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegne
    kalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhw
    iiknswgenwgnkgyilmarnknnacgianlasfpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9vA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm