PDB entry 1u9t

View 1u9t on RCSB PDB site
Description: Crystal Structure Analysis of ChuS, an E. coli Heme Oxygenase
Class: oxidoreductase
Keywords: Structural Genomics, The Montreal-Kingston Bacterial Structural Genomics Initiative, Structural Repeat, Central Beta Sheet, flanked by Alpha helices, BSGI, OXIDOREDUCTASE
Deposited on 2004-08-10, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative heme/hemoglobin transport protein
    Species: Escherichia coli [TaxId:155864]
    Gene: chuS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u9ta1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9tA (A:)
    mgsshhhhhhgsmnhytrwlelkeqnpgkyardiaglmnireaelafarvthdawrmhgd
    irdilaalesvgetkcicrneyavheqvgtftnqhlnghaglilnpraldlrlflnqwas
    vfhikentargerqsiqffdhqgdallkvyatdntdmaawsellarfitdentplelkav
    dapvvqtradatvveqewramtdvhqfftllkrhnltrqqafnlvaddlackvsnsalaq
    ilesaqqdgneimvfvgnrgcvqiftgvvekvvpmkgwlnifnptftlhlleesiaeawv
    trkptsdgyvtslelfahdgtqiaqlygqrtegdqeqaqwrkqiaslipegvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9tA (A:)
    mnhytrwlelkeqardiaglmnireaelafarvthdawrmhgdirdilaalesvgetkci
    crneyavheqvgtftnqhlnghaglilnpraldlrlflnqwasvfhikentargerqsiq
    ffdhqgdallkvyatdntdmaawsellarfitdentplelkvvqtradatvveqewramt
    dvhqfftllkrhnltrqqafnlvaddlackvsnsalaqilesaqqdgneimvfvgnrgcv
    qiftgvvekvvpmkgwlnifnptftlhlleesiaeawvtrkptsdgyvtslelfahdgtq
    iaqlygqrtegdqeqaqwrkqiaslip