PDB entry 1u9r

View 1u9r on RCSB PDB site
Description: Crystal Structure of Staphylococcal Nuclease mutant V66E/P117G/H124L/S128A at Room Temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, nuclease, hyperstable variant, internal waters, HYDROLASE
Deposited on 2004-08-10, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (65)
      • engineered (116)
      • engineered (123)
      • engineered (127)
    Domains in SCOPe 2.08: d1u9ra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1u9rA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmeenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
heqllrkaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >1u9rA (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetvekygpeasaftkkmeenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws