PDB entry 1u9p

View 1u9p on RCSB PDB site
Description: Permuted single-chain Arc
Class: unknown function
Keywords: Arc, pArc, UNKNOWN FUNCTION
Deposited on 2004-08-10, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.249
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pArc
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U9P
    Domains in SCOPe 2.07: d1u9pa1, d1u9pa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9pA (A:)
    mkgmskmpqfnlrwpgggpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkeg
    riggtggsgggrevldlvrkvaeengrsvnseiyqrvmesfkkegrigahhhhhhknqhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9pA (A:)
    mpqfnlrwpgggpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegrigggg
    revldlvrkvaeengrsvnseiyqrvmesfkkegri