PDB entry 1u9m

View 1u9m on RCSB PDB site
Description: Crystal structure of F58W mutant of cytochrome b5
Class: electron transport
Keywords: crystal structure, hemoprotein, F58Y and F58W mutants, conformational changes, aromatic-aromatic interactions, structure-function relationship, ELECTRON TRANSPORT
Deposited on 2004-08-10, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (55)
    Domains in SCOPe 2.07: d1u9ma_
  • Chain 'B':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (55)
    Domains in SCOPe 2.07: d1u9mb_
  • Chain 'C':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (55)
    Domains in SCOPe 2.07: d1u9mc_
  • Chain 'D':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (55)
    Domains in SCOPe 2.07: d1u9md_
  • Chain 'E':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (55)
    Domains in SCOPe 2.07: d1u9me_
  • Chain 'F':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (55)
    Domains in SCOPe 2.07: d1u9mf_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9mA (A:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenwedvg
    hstdarelsktfiigelhpddr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9mB (B:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenwedvg
    hstdarelsktfiigelhpddr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9mC (C:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenwedvg
    hstdarelsktfiigelhpddr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9mD (D:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenwedvg
    hstdarelsktfiigelhpddr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9mE (E:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenwedvg
    hstdarelsktfiigelhpddr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9mF (F:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenwedvg
    hstdarelsktfiigelhpddr