PDB entry 1u9l

View 1u9l on RCSB PDB site
Description: Structural basis for a NusA- protein N interaction
Class: RNA binding protein
Keywords: Escherichia coli NusA, Phage lambda protein N, Regulation of RNA binding, Transcription antitermination, X-ray crystallography
Deposited on 2004-08-10, released 2004-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation protein nusA
  Species: Escherichia coli
  Gene: nusA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03003 (0-End)
  Domains in SCOP 1.75: d1u9la_
• Chain 'B':
  Compound: Transcription elongation protein nusA
  Species: Escherichia coli
  Gene: nusA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03003 (0-69)
  Domains in SCOP 1.75: d1u9lb_
• Chain 'C':
  Compound: Lambda N
  Species: synthetic, synthetic
  
• Heterogens: AU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1u9lA (A:)
  ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
  nalatiaqaq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1u9lA (A:)
  ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
  nalatiaq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u9lB (B:)
  ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
  nalatiaqaq
  

  
  
• Chain 'C':
  No sequence available.