PDB entry 1u9l

View 1u9l on RCSB PDB site
Description: Structural basis for a NusA- protein N interaction
Class: RNA binding protein
Keywords: Escherichia coli NusA, Phage lambda protein N, Regulation of RNA binding, Transcription antitermination, X-ray crystallography
Deposited on 2004-08-10, released 2004-08-31
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation protein nusA
    Species: Escherichia coli
    Gene: nusA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u9la_
  • Chain 'B':
    Compound: Transcription elongation protein nusA
    Species: Escherichia coli
    Gene: nusA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u9lb_
  • Chain 'C':
    Compound: Lambda N
    Species: synthetic, synthetic
  • Heterogens: AU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9lA (A:)
    ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
    nalatiaqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9lA (A:)
    ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
    nalatiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9lB (B:)
    ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
    nalatiaqaq
    

  • Chain 'C':
    No sequence available.