PDB entry 1u9j

View 1u9j on RCSB PDB site
Description: Crystal Structure of E. coli ArnA (PmrI) Decarboxylase Domain
Class: transferase
Keywords: Decarboxylase; X-ray structure; E.coli proteome
Deposited on 2004-08-09, released 2004-10-26
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yfbG
    Species: Escherichia coli
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1u9ja_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9jA (A:)
    hgmsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphf
    hfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvk
    yrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeg
    lqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdird
    giealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrv
    vesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9jA (A:)
    rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
    wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstse
    vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
    gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
    gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesvehrkpsir
    nahrcldwepkidmqetidetldfflrtvdlt