PDB entry 1u9i

View 1u9i on RCSB PDB site
Description: Crystal Structure of Circadian Clock Protein KaiC with Phosphorylation Sites
Class: circadian clock protein
Keywords: homohexamer, circadian, kaia, kaib, kaic, hexamer, clock, CIRCADIAN CLOCK PROTEIN
Deposited on 2004-08-09, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.25
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (430-431)
    Domains in SCOPe 2.07: d1u9ia1, d1u9ia2
  • Chain 'B':
    Compound: KaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (430-431)
    Domains in SCOPe 2.07: d1u9ib1, d1u9ib2
  • Chain 'C':
    Compound: KaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (431)
    Domains in SCOPe 2.07: d1u9ic1, d1u9ic2
  • Chain 'D':
    Compound: KaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (431)
    Domains in SCOPe 2.07: d1u9id1, d1u9id2
  • Chain 'E':
    Compound: KaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (430-431)
    Domains in SCOPe 2.07: d1u9ie1, d1u9ie2
  • Chain 'F':
    Compound: KaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (430-431)
    Domains in SCOPe 2.07: d1u9if1, d1u9if2
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9iA (A:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9iA (A:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u9iB (B:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9iB (B:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u9iC (C:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9iC (C:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u9iD (D:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9iD (D:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u9iE (E:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9iE (E:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u9iF (F:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9iF (F:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri