PDB entry 1u9d

View 1u9d on RCSB PDB site
Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961
Class: structural genomics, unknown function
Keywords: structural genomics, MCSG, hypothetical protein, protein structure initiative, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-08-09, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein VC0714
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VC0714
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU16 (15-121)
      • cloning artifact (0-14)
      • modified residue (15)
      • modified residue (68)
    Domains in SCOPe 2.07: d1u9da1, d1u9da2
  • Chain 'B':
    Compound: hypothetical protein VC0714
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VC0714
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU16 (15-121)
      • cloning artifact (0-14)
      • modified residue (15)
      • modified residue (68)
    Domains in SCOPe 2.07: d1u9db1, d1u9db2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9dA (A:)
    gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
    faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
    hf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9dB (B:)
    gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
    faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
    hf