PDB entry 1u9d
View 1u9d on RCSB PDB site
Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961
Class: structural genomics, unknown function
Keywords: structural genomics, MCSG, hypothetical protein, protein structure initiative, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on
2004-08-09, released
2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hypothetical protein VC0714
Species: Vibrio cholerae [TaxId:243277]
Gene: VC0714
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KU16 (15-121)
- cloning artifact (0-14)
- modified residue (15)
- modified residue (68)
Domains in SCOPe 2.07: d1u9da1, d1u9da2 - Chain 'B':
Compound: hypothetical protein VC0714
Species: Vibrio cholerae [TaxId:243277]
Gene: VC0714
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KU16 (15-121)
- cloning artifact (0-14)
- modified residue (15)
- modified residue (68)
Domains in SCOPe 2.07: d1u9db1, d1u9db2 - Heterogens: PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1u9dA (A:)
gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
hf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1u9dB (B:)
gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
hf