PDB entry 1u9d

View 1u9d on RCSB PDB site
Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961
Class: structural genomics, unknown function
Keywords: structural genomics, MCSG, hypothetical protein, protein structure initiative, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-08-09, released 2004-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein VC0714
  Species: Vibrio cholerae [TaxId:243277]
  Gene: VC0714
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KU16 (15-121)
    • cloning artifact (0-14)
    • modified residue (15)
    • modified residue (68)
  Domains in SCOPe 2.06: d1u9da1, d1u9da2
• Chain 'B':
  Compound: hypothetical protein VC0714
  Species: Vibrio cholerae [TaxId:243277]
  Gene: VC0714
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KU16 (15-121)
    • cloning artifact (0-14)
    • modified residue (15)
    • modified residue (68)
  Domains in SCOPe 2.06: d1u9db1, d1u9db2
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u9dA (A:)
  gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
  faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
  hf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u9dB (B:)
  gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
  faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
  hf