PDB entry 1u9d

View 1u9d on RCSB PDB site
Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961
Deposited on 2004-08-09, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1u9da_
  • Chain 'B':
    Domains in SCOP 1.69: d1u9db_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9dA (A:)
    gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
    faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
    hf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u9dB (B:)
    gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
    faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
    hf