PDB entry 1u9c

View 1u9c on RCSB PDB site
Description: Crystallographic structure of APC35852
Class: structural genomics, unknown function
Keywords: structural genomics, protein structure initiative, MCSG, Parkinson's disease, chaperone, cysteine protease, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-08-09, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.173
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apc35852
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U9C (Start-223)
    Domains in SCOPe 2.08: d1u9ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u9cA (A:)
    snamskrvlmvvtnhttitddhktglwleefavpylvfqekgydvkvasiqggevpldpr
    sinekdpswaeaeaalkhtarlskddahgfdaiflpgghgtmfdfpdnetlqyvlqqfae
    dgriiaavchgpsglvnatykdgtpivkgktvtsftdeeerevgldvhmpfllestlrlr
    ganfvrggkwtdfsvrdgnlitgqnpqssrstaekvvaaleere
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u9cA (A:)
    mskrvlmvvtnhttitddhktglwleefavpylvfqekgydvkvasiqggevpldprsin
    ekdpswaeaeaalkhtarlskddahgfdaiflpgghgtmfdfpdnetlqyvlqqfaedgr
    iiaavchgpsglvnatykdgtpivkgktvtsftdeeerevgldvhmpfllestlrlrgan
    fvrggkwtdfsvrdgnlitgqnpqssrstaekvvaaleere