PDB entry 1u99

View 1u99 on RCSB PDB site
Description: crystal structures of e. coli reca in a compressed helical filament form 4
Deposited on 2004-08-09, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u99A (A:)
    gshmaidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgaggl
    pmgriveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllc
    sqpdtgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamr
    klagnlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegen
    vvgsetrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykge
    kigqgkanatawlkdnpetakeiekkvrelllsnpnstpdfsvddsegvaetnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u99A (A:)
    kqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiy
    gpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqa
    leicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntllifin
    qttggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilygeg
    infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrell
    l