PDB entry 1u97

View 1u97 on RCSB PDB site
Description: Solution Structure of Apo Yeast Cox17
Class: chaperone
Keywords: Metallochaperone, Unstructured N-terminus, Two Alpha-Helices, Cytochrome c Oxidase
Deposited on 2004-08-09, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c oxidase copper chaperone
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: COX17
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12287 (1-68)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d1u97a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u97A (A:)
  mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg
  ygfevpsan