PDB entry 1u96

View 1u96 on RCSB PDB site
Description: solution structure of yeast cox17 with copper bound
Deposited on 2004-08-09, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1u96a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u96A (A:)
  mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg
  ygfevpsan