PDB entry 1u95

View 1u95 on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDHWAS
Class: immune system
Keywords: Fab complex, HIV-1 Neutralization, gp41 Peptide
Deposited on 2004-08-09, released 2004-10-05
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody 2f5 (light chain)
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1u95a1, d1u95a2
  • Chain 'B':
    Compound: antibody 2f5 (heavy chain)
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1u95b1, d1u95b2
  • Chain 'C':
    Compound: gp41 peptide
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u95A (A:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyecevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u95B (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstagaaaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u95B (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapgaaaalgclvkdyfpepvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslqtytcnvnhkpsntkvdkrvepksc
    

  • Chain 'C':
    No sequence available.