PDB entry 1u94

View 1u94 on RCSB PDB site
Description: Crystal Structure of E. Coli RecA in a Compressed Helical Filament Form 2
Class: DNA binding protein
Keywords: RecA, homologous recombination, ATPase, DNA repair, DNA BINDING PROTEIN
Deposited on 2004-08-09, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reca protein
    Species: Escherichia coli [TaxId:562]
    Gene: recA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u94a1, d1u94a2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u94A (A:)
    gshmaidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgaggl
    pmgriveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllc
    sqpdtgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamr
    klagnlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegen
    vvgsetrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykge
    kigqgkanatawlkdnpetakeiekkvrelllsnpnstpdfsvddsegvaetnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u94A (A:)
    kqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiy
    gpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqa
    leicdalarsgavdvivvdsvaaltpkaeiegeglaarmmsqamrklagnlkqsntllif
    inqttggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilyg
    eginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvre
    lllsnp